Lineage for d2r83b2 (2r83 B:140-267)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772982Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2772983Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries)
  8. 2772995Domain d2r83b2: 2r83 B:140-267 [238851]
    automated match to d1dqva1
    complexed with cl

Details for d2r83b2

PDB Entry: 2r83 (more details), 2.7 Å

PDB Description: crystal structure analysis of human synaptotagmin 1 c2a-c2b
PDB Compounds: (B:) Synaptotagmin-1

SCOPe Domain Sequences for d2r83b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r83b2 b.7.1.2 (B:140-267) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselagktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

SCOPe Domain Coordinates for d2r83b2:

Click to download the PDB-style file with coordinates for d2r83b2.
(The format of our PDB-style files is described here.)

Timeline for d2r83b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r83b1