PDB entry 2r83

View 2r83 on RCSB PDB site
Description: Crystal structure analysis of human synaptotagmin 1 C2A-C2B
Class: endocytosis, exocytosis
Keywords: C2A-C2B, EXOCYTOSIS, Calcium, Cell junction, Cytoplasmic vesicle, Glycoprotein, Lipoprotein, Membrane, Metal-binding, Palmitate, Phosphorylation, Synapse, Transmembrane, ENDOCYTOSIS/EXOCYTOSIS COMPLEX, ENDOCYTOSIS
Deposited on 2007-09-10, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21579 (2-End)
      • conflict (82)
    Domains in SCOPe 2.07: d2r83a1, d2r83a2
  • Chain 'B':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21579 (2-End)
      • conflict (82)
    Domains in SCOPe 2.07: d2r83b1, d2r83b2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r83A (A:)
    gseklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkv
    hrktlnpvfneqftfkvpyselagktlvmavydfdrfskhdiigefkvpmntvdfghvte
    ewrdlqsaekeeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlm
    qngkrlkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvf
    vgynstgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r83A (A:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselagktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsaekeeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqn
    gkrlkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvg
    ynstgaelrhwsdmlanprrpiaqwhtlqveeevdamla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r83B (B:)
    gseklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkv
    hrktlnpvfneqftfkvpyselagktlvmavydfdrfskhdiigefkvpmntvdfghvte
    ewrdlqsaekeeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlm
    qngkrlkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvf
    vgynstgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r83B (B:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselagktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsaekeeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqn
    gkrlkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvg
    ynstgaelrhwsdmlanprrpiaqwhtlqveeevdamla