| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
| Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries) |
| Domain d2r83a2: 2r83 A:140-267 [238850] automated match to d1dqva1 complexed with cl |
PDB Entry: 2r83 (more details), 2.7 Å
SCOPe Domain Sequences for d2r83a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r83a2 b.7.1.2 (A:140-267) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselagktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek
Timeline for d2r83a2: