Lineage for d2r25a_ (2r25 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700197Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2700210Protein Phosphorelay protein ypd1 [47231] (2 species)
  7. 2700211Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)
  8. 2700214Domain d2r25a_: 2r25 A: [151529]
    Other proteins in same PDB: d2r25b_
    automated match to d1c03a_
    complexed with bef, mg, na

Details for d2r25a_

PDB Entry: 2r25 (more details), 1.7 Å

PDB Description: complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
PDB Compounds: (A:) Phosphorelay intermediate protein YPD1

SCOPe Domain Sequences for d2r25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r25a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

SCOPe Domain Coordinates for d2r25a_:

Click to download the PDB-style file with coordinates for d2r25a_.
(The format of our PDB-style files is described here.)

Timeline for d2r25a_: