SCOPe 2.07: Domain d2r25a_: 2r25 A:

Lineage for d2r25a_ (2r25 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Phosphorelay protein ypd1 [47231] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)

8. Domain d2r25a_: 2r25 A: [151529]
   Other proteins in same PDB: d2r25b_
   automated match to d1c03a_
   complexed with bef, mg, na

Details for d2r25a_

PDB Entry: 2r25, 1.7 Å

PDB Description: complex of ypd1 and sln1-r1 with bound mg2+ and bef3-

PDB Compounds: (A:) Phosphorelay intermediate protein YPD1

SCOPe Domain Sequences for d2r25a_:

Sequence; same for both SEQRES and ATOM records:

>d2r25a_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

Timeline for d2r25a_:

• d2r25a_ first appeared in SCOP 1.75, called d2r25a1
  
• d2r25a_ appears in SCOPe 2.06
  
• d2r25a_ appears in the current release, SCOPe 2.08