PDB entry 2r25

View 2r25 on RCSB PDB site
Description: Complex of YPD1 and SLN1-R1 with bound Mg2+ and BeF3-
Class: Signaling PROTEIN/Transferase
Keywords: alpha5-beta5, response regulator, four helix bundle, histidine phosphotransfer (HPt) protein, histidine kinase (HK), Cytoplasm, Nucleus, Phosphorylation, Two-component regulatory system, Glycoprotein, Magnesium, Membrane, Metal-binding, Transferase, Transmembrane, Signaling PROTEIN/Transferase COMPLEX
Deposited on 2007-08-24, released 2008-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphorelay intermediate protein YPD1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r25a_
  • Chain 'B':
    Compound: Osmosensing histidine protein kinase SLN1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SLN1, YPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r25b_
  • Heterogens: MG, NA, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r25A (A:)
    mstipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteld
    nlghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginided
    deeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r25A (A:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r25B (B:)
    tsvkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdv
    qmpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklkti
    ltefcaayqgkkn