Lineage for d2qlsb1 (2qls B:1-146)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977449Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries)
  8. 1977453Domain d2qlsb1: 2qls B:1-146 [150864]
    automatically matched to d1fhjb_
    complexed with hem

Details for d2qlsb1

PDB Entry: 2qls (more details), 3.5 Å

PDB Description: crystal structure of hemoglobin from dog (canis familiaris) at 3.5 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2qlsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlsb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2qlsb1:

Click to download the PDB-style file with coordinates for d2qlsb1.
(The format of our PDB-style files is described here.)

Timeline for d2qlsb1: