SCOPe 2.08: Domain d2qlsd1: 2qls D:1-146

Lineage for d2qlsd1 (2qls D:1-146)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries)

8. Domain d2qlsd1: 2qls D:1-146 [150865]
   automatically matched to d1fhjb_
   complexed with hem

Details for d2qlsd1

PDB Entry: 2qls, 3.5 Å

PDB Description: crystal structure of hemoglobin from dog (canis familiaris) at 3.5 angstrom resolution

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2qlsd1:

Sequence; same for both SEQRES and ATOM records:

>d2qlsd1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

Timeline for d2qlsd1:

• d2qlsd1 first appeared in SCOP 1.75
  
• d2qlsd1 appears in SCOPe 2.07