Lineage for d2qlsd1 (2qls D:1-146)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687071Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries)
  8. 2687076Domain d2qlsd1: 2qls D:1-146 [150865]
    automatically matched to d1fhjb_
    complexed with hem

Details for d2qlsd1

PDB Entry: 2qls (more details), 3.5 Å

PDB Description: crystal structure of hemoglobin from dog (canis familiaris) at 3.5 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2qlsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlsd1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2qlsd1:

Click to download the PDB-style file with coordinates for d2qlsd1.
(The format of our PDB-style files is described here.)

Timeline for d2qlsd1: