Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Canis lupus familiaris [TaxId:9615] [158218] (1 PDB entry) |
Domain d2qlsb1: 2qls B:1-146 [150864] automatically matched to d1fhjb_ complexed with hem |
PDB Entry: 2qls (more details), 3.5 Å
SCOP Domain Sequences for d2qlsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlsb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Canis lupus familiaris [TaxId: 9615]} vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d2qlsb1: