SCOP 1.75: Domain d2qlsb1: 2qls B:1-146

Lineage for d2qlsb1 (2qls B:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Canis lupus familiaris [TaxId:9615] [158218] (1 PDB entry)

8. Domain d2qlsb1: 2qls B:1-146 [150864]
   automatically matched to d1fhjb_
   complexed with hem

Details for d2qlsb1

PDB Entry: 2qls, 3.5 Å

PDB Description: crystal structure of hemoglobin from dog (canis familiaris) at 3.5 angstrom resolution

PDB Compounds: (B:) Hemoglobin subunit beta

SCOP Domain Sequences for d2qlsb1:

Sequence; same for both SEQRES and ATOM records:

>d2qlsb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Canis lupus familiaris [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

Timeline for d2qlsb1:

• d2qlsb1 is new in SCOP 1.75
  
• d2qlsb1 appears in SCOPe 2.01
  
• d2qlsb1 appears in the current release, SCOPe 2.08