SCOPe 2.08: Domain d2q0zx1: 2q0z X:33-208

Lineage for d2q0zx1 (2q0z X:33-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
   multihelical; consists of two helical subdomains

4. Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families)

5. Family a.289.1.1: Sec63 N-terminal domain [158703] (1 protein)
   N-terminal part of Pfam PF02889

6. Protein Protein pro2281 [158704] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158705] (1 PDB entry)
   Uniprot Q9P172 33-208

8. Domain d2q0zx1: 2q0z X:33-208 [149993]
   Other proteins in same PDB: d2q0zx2

Details for d2q0zx1

PDB Entry: 2q0z, 2 Å

PDB Description: crystal structure of q9p172/sec63 from homo sapiens. northeast structural genomics target hr1979.

PDB Compounds: (X:) Protein PRO2281

SCOPe Domain Sequences for d2q0zx1:

Sequence; same for both SEQRES and ATOM records:

>d2q0zx1 a.289.1.1 (X:33-208) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]}
tkvrglieiisnaaeyenipirhhednllrqlaqkvphklnnpkfndphvktnlllqahl
srmqlsaelqsdteeilskairliqacvdvlssngwlspalaamelaqmvtqamwskdsy
lkqlphftsehikrctdkgvesvfdimemedeernallqltdsqiadvarfcnryp

Timeline for d2q0zx1:

• d2q0zx1 first appeared in SCOP 1.75
  
• d2q0zx1 appears in SCOPe 2.07