SCOPe 2.08: Domain d2q0zx2: 2q0z X:209-322

Lineage for d2q0zx2 (2q0z X:209-322)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.22: Sec63 C-terminal domain-like [158893] (1 protein)
   C-terminal part of Pfam PF02889

6. Protein Protein pro2281 [158894] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158895] (1 PDB entry)
   Uniprot Q9P172 209-322

8. Domain d2q0zx2: 2q0z X:209-322 [149994]
   Other proteins in same PDB: d2q0zx1

Details for d2q0zx2

PDB Entry: 2q0z, 2 Å

PDB Description: crystal structure of q9p172/sec63 from homo sapiens. northeast structural genomics target hr1979.

PDB Compounds: (X:) Protein PRO2281

SCOPe Domain Sequences for d2q0zx2:

Sequence; same for both SEQRES and ATOM records:

>d2q0zx2 b.1.18.22 (X:209-322) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]}
nielsyevvdkdsirsggpvvvlvqlereeevtgpviaplfpqkreegwwvvigdaksns
lisikrltlqqkakvkldfvapatgahnytlyfmsdaymgcdqeykfsvdvkea

Timeline for d2q0zx2:

• d2q0zx2 first appeared in SCOP 1.75
  
• d2q0zx2 appears in SCOPe 2.07