Lineage for d2q0zx1 (2q0z X:33-208)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781478Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
    multihelical; consists of two helical subdomains
  4. 781479Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (2 families) (S)
  5. 781480Family a.289.1.1: Sec63 N-terminal domain [158703] (1 protein)
    N-terminal part of Pfam PF02889
  6. 781481Protein Protein pro2281 [158704] (1 species)
  7. 781482Species Human (Homo sapiens) [TaxId:9606] [158705] (1 PDB entry)
    Uniprot Q9P172 33-208
  8. 781483Domain d2q0zx1: 2q0z X:33-208 [149993]
    Other proteins in same PDB: d2q0zx2

Details for d2q0zx1

PDB Entry: 2q0z (more details), 2 Å

PDB Description: crystal structure of q9p172/sec63 from homo sapiens. northeast structural genomics target hr1979.
PDB Compounds: (X:) Protein PRO2281

SCOP Domain Sequences for d2q0zx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q0zx1 a.289.1.1 (X:33-208) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]}
tkvrglieiisnaaeyenipirhhednllrqlaqkvphklnnpkfndphvktnlllqahl
srmqlsaelqsdteeilskairliqacvdvlssngwlspalaamelaqmvtqamwskdsy
lkqlphftsehikrctdkgvesvfdimemedeernallqltdsqiadvarfcnryp

SCOP Domain Coordinates for d2q0zx1:

Click to download the PDB-style file with coordinates for d2q0zx1.
(The format of our PDB-style files is described here.)

Timeline for d2q0zx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q0zx2