PDB entry 2q0z

View 2q0z on RCSB PDB site
Description: Crystal structure of Q9P172/Sec63 from Homo sapiens. Northeast Structural Genomics Target HR1979.
Class: protein transport
Keywords: sec63, sec, NESG, hr1979, structural genomics, translocase, Northeast Structural Genomics Consortium, PSI-2, Protein Structure Initiative, PROTEIN TRANSPORT
Deposited on 2007-05-23, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Protein PRO2281
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P172
      • modified residue (104)
      • modified residue (145)
      • modified residue (150)
      • modified residue (155)
      • modified residue (188)
      • modified residue (190)
      • modified residue (311)
      • modified residue (316)
    Domains in SCOPe 2.07: d2q0zx1, d2q0zx2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2q0zX (X:)
    mghhhhhhshmdvaplnlgmiaayyyinyttielfsmslnaktkvrglieiisnaaeyen
    ipirhhednllrqlaqkvphklnnpkfndphvktnlllqahlsrmqlsaelqsdteeils
    kairliqacvdvlssngwlspalaamelaqmvtqamwskdsylkqlphftsehikrctdk
    gvesvfdimemedeernallqltdsqiadvarfcnrypnielsyevvdkdsirsggpvvv
    lvqlereeevtgpviaplfpqkreegwwvvigdaksnslisikrltlqqkakvkldfvap
    atgahnytlyfmsdaymgcdqeykfsvdvkeaetdsdsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q0zX (X:)
    tkvrglieiisnaaeyenipirhhednllrqlaqkvphklnnpkfndphvktnlllqahl
    srmqlsaelqsdteeilskairliqacvdvlssngwlspalaamelaqmvtqamwskdsy
    lkqlphftsehikrctdkgvesvfdimemedeernallqltdsqiadvarfcnrypniel
    syevvdkdsirsggpvvvlvqlereeevtgpviaplfpqkreegwwvvigdaksnslisi
    krltlqqkakvkldfvapatgahnytlyfmsdaymgcdqeykfsvdvkea