Class a: All alpha proteins [46456] (290 folds) |
Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) |
Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
Protein RuBisCo chaperone RbcX [158617] (5 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [158620] (1 PDB entry) Uniprot Q55670 4-123 |
Domain d2py8c_: 2py8 C: [149937] automated match to d2py8a1 complexed with cl, pe4 |
PDB Entry: 2py8 (more details), 2.45 Å
SCOPe Domain Sequences for d2py8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2py8c_ a.280.1.1 (C:) RuBisCo chaperone RbcX {Synechocystis sp. PCC 6803 [TaxId: 1148]} qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell denkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfps ets
Timeline for d2py8c_: