PDB entry 2py8

View 2py8 on RCSB PDB site
Description: RbcX
Class: chaperone
Keywords: All helical fold, CHAPERONE
Deposited on 2007-05-15, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein rbcX
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2py8a1
  • Chain 'B':
    Compound: Hypothetical protein rbcX
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2py8b_
  • Chain 'C':
    Compound: Hypothetical protein rbcX
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2py8c_
  • Chain 'D':
    Compound: Hypothetical protein rbcX
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2py8d_
  • Heterogens: CL, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2py8A (A:)
    mqtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltel
    ldenkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfp
    setsngesnnndsppsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py8A (A:)
    qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell
    denkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2py8B (B:)
    mqtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltel
    ldenkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfp
    setsngesnnndsppsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py8B (B:)
    qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell
    denkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2py8C (C:)
    mqtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltel
    ldenkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfp
    setsngesnnndsppsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py8C (C:)
    qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell
    denkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfps
    ets
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2py8D (D:)
    mqtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltel
    ldenkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfp
    setsngesnnndsppsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2py8D (D:)
    qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell
    denkelvlrilavrediaesvldflpgmtrnslaesniahrrh