![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
![]() | Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
![]() | Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
![]() | Protein RuBisCo chaperone RbcX [158617] (5 species) |
![]() | Species Synechocystis sp. PCC 6803 [TaxId:1148] [158620] (1 PDB entry) Uniprot Q55670 4-123 |
![]() | Domain d2py8a1: 2py8 A:2-121 [149935] complexed with cl, pe4 |
PDB Entry: 2py8 (more details), 2.45 Å
SCOPe Domain Sequences for d2py8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2py8a1 a.280.1.1 (A:2-121) RuBisCo chaperone RbcX {Synechocystis sp. PCC 6803 [TaxId: 1148]} qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell denkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfps
Timeline for d2py8a1: