Lineage for d2py8c1 (2py8 C:2-121)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781293Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 781294Superfamily a.280.1: RbcX-like [158615] (1 family) (S)
  5. 781295Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 781296Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 781348Species Synechocystis sp., strain PCC 6803 [TaxId:1148] [158620] (1 PDB entry)
    Uniprot Q55670 4-123
  8. 781351Domain d2py8c1: 2py8 C:2-121 [149937]
    automatically matched to 2PY8 A:2-121
    complexed with cl, pe4

Details for d2py8c1

PDB Entry: 2py8 (more details), 2.45 Å

PDB Description: rbcx
PDB Compounds: (C:) Hypothetical protein rbcX

SCOP Domain Sequences for d2py8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2py8c1 a.280.1.1 (C:2-121) RuBisCo chaperone RbcX {Synechocystis sp., strain PCC 6803 [TaxId: 1143]}
qtkhiaqatvkvlqsyltyqavlriqselgetnppqaiwlnqylashsiqngetfltell
denkelvlrilavrediaesvldflpgmtrnslaesniahrrhllerltrtvaevdnfps

SCOP Domain Coordinates for d2py8c1:

Click to download the PDB-style file with coordinates for d2py8c1.
(The format of our PDB-style files is described here.)

Timeline for d2py8c1: