SCOPe 2.02: Domain d2pu9a_: 2pu9 A:

Lineage for d2pu9a_ (2pu9 A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family)

5. Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein)

6. Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (1 species)

7. Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries)

8. Domain d2pu9a_: 2pu9 A: [149856]
   Other proteins in same PDB: d2pu9b_, d2pu9c_
   automated match to d1dj7a_
   complexed with sf4, so4

Details for d2pu9a_

PDB Entry: 2pu9, 1.65 Å

PDB Description: crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f

PDB Compounds: (A:) Ferredoxin-thioredoxin reductase, catalytic chain

SCOPe Domain Sequences for d2pu9a_:

Sequence; same for both SEQRES and ATOM records:

>d2pu9a_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]}
nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkasma

Timeline for d2pu9a_:

• d2pu9a_ first appeared in SCOP 1.75, called d2pu9a1
  
• d2pu9a_ appears in SCOPe 2.01
  
• d2pu9a_ appears in SCOPe 2.03
  
• d2pu9a_ appears in the current release, SCOPe 2.08