Lineage for d1dj7a_ (1dj7 A:)
- Root: SCOPe 2.02
Class g: Small proteins [56992] (90 folds) 
Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
folds around 4Fe-4S clusterSuperfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) 
Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein) Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (1 species) Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries) 
Domain d1dj7a_: 1dj7 A: [44997]
Other proteins in same PDB: d1dj7b_
complexed with sf4, so4
Details for d1dj7a_
PDB Entry: 1dj7 (more details), 1.6 Å
PDB Description: crystal structure of ferredoxin thioredoxin reductase
PDB Compounds: (A:) ferredoxin thioredoxin reductase: catalytic chainSCOPe Domain Sequences for d1dj7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dj7a_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]}
nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
SCOPe Domain Coordinates for d1dj7a_:
Click to download the PDB-style file with coordinates for d1dj7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dj7a_:
- d1dj7a_ first appeared (with stable ids) in SCOP 1.55
- d1dj7a_ appears in SCOPe 2.01
- d1dj7a_ appears in SCOPe 2.03
- d1dj7a_ appears in the current release, SCOPe 2.08
View in 3D
