SCOPe 2.08: Domain d1dj7a_: 1dj7 A:

Lineage for d1dj7a_ (1dj7 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family)
   automatically mapped to Pfam PF02943

5. Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein)

6. Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species)

7. Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries)

8. Domain d1dj7a_: 1dj7 A: [44997]
   Other proteins in same PDB: d1dj7b_
   complexed with sf4, so4

Details for d1dj7a_

PDB Entry: 1dj7, 1.6 Å

PDB Description: crystal structure of ferredoxin thioredoxin reductase

PDB Compounds: (A:) ferredoxin thioredoxin reductase: catalytic chain

SCOPe Domain Sequences for d1dj7a_:

Sequence; same for both SEQRES and ATOM records:

>d1dj7a_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]}
nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas

Timeline for d1dj7a_:

• d1dj7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dj7a_ appears in SCOPe 2.07