Lineage for d1dj7a_ (1dj7 A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
    folds around 4Fe-4S cluster
  4. Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) (S)
    automatically mapped to Pfam PF02943
  5. Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein)
  6. Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species)
  7. Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries)
  8. Domain d1dj7a_: 1dj7 A: [44997]
    Other proteins in same PDB: d1dj7b_
    complexed with sf4, so4

Details for d1dj7a_

PDB Entry: 1dj7 (more details), 1.6 Å

PDB Description: crystal structure of ferredoxin thioredoxin reductase
PDB Compounds: (A:) ferredoxin thioredoxin reductase: catalytic chain

SCOPe Domain Sequences for d1dj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj7a_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]}
nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas

SCOPe Domain Coordinates for d1dj7a_ are not available.

Timeline for d1dj7a_:

Domains from other chains:
(mouse over for more information)
d1dj7b_