Lineage for d2pu9a_ (2pu9 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586318Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2586319Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) (S)
    automatically mapped to Pfam PF02943
  5. 2586320Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein)
  6. 2586321Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (1 species)
  7. 2586322Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries)
  8. 2586324Domain d2pu9a_: 2pu9 A: [149856]
    Other proteins in same PDB: d2pu9b_, d2pu9c_
    automated match to d1dj7a_
    complexed with sf4, so4

Details for d2pu9a_

PDB Entry: 2pu9 (more details), 1.65 Å

PDB Description: crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
PDB Compounds: (A:) Ferredoxin-thioredoxin reductase, catalytic chain

SCOPe Domain Sequences for d2pu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pu9a_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]}
nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkasma

SCOPe Domain Coordinates for d2pu9a_:

Click to download the PDB-style file with coordinates for d2pu9a_.
(The format of our PDB-style files is described here.)

Timeline for d2pu9a_: