Lineage for d2pu9b_ (2pu9 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1121103Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1121129Family b.34.4.3: Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50098] (1 protein)
  6. 1121130Protein Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50099] (1 species)
  7. 1121131Species Synechocystis sp. [TaxId:1143] [50100] (7 PDB entries)
  8. 1121132Domain d2pu9b_: 2pu9 B: [149857]
    Other proteins in same PDB: d2pu9a_, d2pu9c_
    automated match to d1dj7b_
    complexed with sf4, so4

Details for d2pu9b_

PDB Entry: 2pu9 (more details), 1.65 Å

PDB Description: crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
PDB Compounds: (B:) Ferredoxin-thioredoxin reductase, variable chain

SCOPe Domain Sequences for d2pu9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pu9b_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtlie

SCOPe Domain Coordinates for d2pu9b_:

Click to download the PDB-style file with coordinates for d2pu9b_.
(The format of our PDB-style files is described here.)

Timeline for d2pu9b_: