SCOPe 2.08: Domain d2pmab2: 2pma B:26-166

Lineage for d2pmab2 (2pma B:26-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.3: LPG0085-like [159190] (1 protein)
   Pfam PF05618; DUF785; single-domain protein similar to one pepsin domain with the conserved catalytic Asp motif (not in a few archaeal members of this Pfam family)

6. Protein Uncharacterized protein LPG0085 [159191] (1 species)

7. Species Legionella pneumophila [TaxId:446] [159192] (1 PDB entry)
   Uniprot Q5ZZC6 26-166

8. Domain d2pmab2: 2pma B:26-166 [149658]
   Other proteins in same PDB: d2pmaa2, d2pmab3
   automated match to d2pmaa1
   complexed with act, fmt

Details for d2pmab2

PDB Entry: 2pma, 1.89 Å

PDB Description: structural genomics, the crystal structure of a protein lpg0085 with unknown function (duf785) from legionella pneumophila subsp. pneumophila str. philadelphia 1.

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2pmab2:

Sequence, based on SEQRES records:

>d2pmab2 b.50.1.3 (B:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]}
iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe
geyvgkvkikvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyplll
grdaiidfngavdpaltfttk

Sequence, based on observed residues (ATOM records):

>d2pmab2 b.50.1.3 (B:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]}
iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe
geyvgkvpikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngavdpalt
fttk

Timeline for d2pmab2:

• d2pmab2 first appeared in SCOP 1.75, called d2pmab1
  
• d2pmab2 appears in SCOPe 2.07