Lineage for d2pmab2 (2pma B:26-166)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2411972Family b.50.1.3: LPG0085-like [159190] (1 protein)
    Pfam PF05618; DUF785; single-domain protein similar to one pepsin domain with the conserved catalytic Asp motif (not in a few archaeal members of this Pfam family)
  6. 2411973Protein Uncharacterized protein LPG0085 [159191] (1 species)
  7. 2411974Species Legionella pneumophila [TaxId:446] [159192] (1 PDB entry)
    Uniprot Q5ZZC6 26-166
  8. 2411976Domain d2pmab2: 2pma B:26-166 [149658]
    Other proteins in same PDB: d2pmaa2, d2pmab3
    automated match to d2pmaa1
    complexed with act, fmt

Details for d2pmab2

PDB Entry: 2pma (more details), 1.89 Å

PDB Description: structural genomics, the crystal structure of a protein lpg0085 with unknown function (duf785) from legionella pneumophila subsp. pneumophila str. philadelphia 1.
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2pmab2:

Sequence, based on SEQRES records: (download)

>d2pmab2 b.50.1.3 (B:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]}
iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe
geyvgkvkikvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyplll
grdaiidfngavdpaltfttk

Sequence, based on observed residues (ATOM records): (download)

>d2pmab2 b.50.1.3 (B:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]}
iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe
geyvgkvpikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngavdpalt
fttk

SCOPe Domain Coordinates for d2pmab2:

Click to download the PDB-style file with coordinates for d2pmab2.
(The format of our PDB-style files is described here.)

Timeline for d2pmab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pmab3