![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.3: LPG0085-like [159190] (1 protein) Pfam PF05618; DUF785; single-domain protein similar to one pepsin domain with the conserved catalytic Asp motif (not in a few archaeal members of this Pfam family) |
![]() | Protein Uncharacterized protein LPG0085 [159191] (1 species) |
![]() | Species Legionella pneumophila [TaxId:446] [159192] (1 PDB entry) Uniprot Q5ZZC6 26-166 |
![]() | Domain d2pmaa1: 2pma A:26-166 [149657] Other proteins in same PDB: d2pmaa2, d2pmab3 complexed with act, fmt |
PDB Entry: 2pma (more details), 1.89 Å
SCOPe Domain Sequences for d2pmaa1:
Sequence, based on SEQRES records: (download)
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe geyvgkvkikvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyplll grdaiidfngavdpaltfttk
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe geyvgkvkipikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngavdpa ltfttk
Timeline for d2pmaa1: