PDB entry 2pma

View 2pma on RCSB PDB site
Description: Structural Genomics, the crystal structure of a protein Lpg0085 with unknown function (DUF785) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1.
Class: structural genomics, unknown function
Keywords: APC86035.2, protein Lpg0085, DUF785, Legionella pneumophila subsp. pneumophila str. Philadelphia 1, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-04-20, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Legionella pneumophila [TaxId:272624]
    Gene: lpg0085
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZZC6 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2pmaa1, d2pmaa2
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Legionella pneumophila [TaxId:272624]
    Gene: lpg0085
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZZC6 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2pmab2, d2pmab3
  • Heterogens: ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pmaA (A:)
    snaiygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdy
    sfegeyvgkvkikvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyp
    lllgrdaiidfngavdpaltfttksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmaA (A:)
    snaiygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdy
    sfegeyvgkvkipikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngav
    dpaltfttk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pmaB (B:)
    snaiygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdy
    sfegeyvgkvkikvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyp
    lllgrdaiidfngavdpaltfttksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmaB (B:)
    snaiygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdy
    sfegeyvgkvpikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngavdp
    altfttk