Lineage for d2pmab1 (2pma B:26-166)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 804800Family b.50.1.3: LPG0085-like [159190] (1 protein)
    Pfam PF05618; DUF785; single-domain protein similar to one pepsin domain with the conserved catalytic Asp motif (not in a few archaeal members of this Pfam family)
  6. 804801Protein Uncharacterized protein LPG0085 [159191] (1 species)
  7. 804802Species Legionella pneumophila [TaxId:446] [159192] (1 PDB entry)
    Uniprot Q5ZZC6 26-166
  8. 804804Domain d2pmab1: 2pma B:26-166 [149658]
    automatically matched to 2PMA A:26-166
    complexed with act, fmt

Details for d2pmab1

PDB Entry: 2pma (more details), 1.89 Å

PDB Description: structural genomics, the crystal structure of a protein lpg0085 with unknown function (duf785) from legionella pneumophila subsp. pneumophila str. philadelphia 1.
PDB Compounds: (B:) Uncharacterized protein

SCOP Domain Sequences for d2pmab1:

Sequence, based on SEQRES records: (download)

>d2pmab1 b.50.1.3 (B:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]}
iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe
geyvgkvkikvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyplll
grdaiidfngavdpaltfttk

Sequence, based on observed residues (ATOM records): (download)

>d2pmab1 b.50.1.3 (B:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]}
iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfe
geyvgkvpikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngavdpalt
fttk

SCOP Domain Coordinates for d2pmab1:

Click to download the PDB-style file with coordinates for d2pmab1.
(The format of our PDB-style files is described here.)

Timeline for d2pmab1: