Lineage for d2pi2f_ (2pi2 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789537Protein automated matches [190206] (10 species)
    not a true protein
  7. 2789550Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)
  8. 2789572Domain d2pi2f_: 2pi2 F: [149498]
    Other proteins in same PDB: d2pi2a_, d2pi2b_, d2pi2c_, d2pi2d_
    automated match to d3kdfc_
    complexed with dio

Details for d2pi2f_

PDB Entry: 2pi2 (more details), 2 Å

PDB Description: Full-length Replication protein A subunits RPA14 and RPA32
PDB Compounds: (F:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d2pi2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi2f_ b.40.4.3 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmeplde
eisgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgivqh

SCOPe Domain Coordinates for d2pi2f_:

Click to download the PDB-style file with coordinates for d2pi2f_.
(The format of our PDB-style files is described here.)

Timeline for d2pi2f_: