![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries) |
![]() | Domain d2pi2a_: 2pi2 A: [149493] Other proteins in same PDB: d2pi2e_, d2pi2f_, d2pi2g_, d2pi2h_ automated match to d2pqaa_ complexed with dio |
PDB Entry: 2pi2 (more details), 2 Å
SCOPe Domain Sequences for d2pi2a_:
Sequence, based on SEQRES records: (download)
>d2pi2a_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} araqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaa pmdvrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthil evinahmvlskansqp
>d2pi2a_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} araqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaa pmdvrqwvdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahm vlskansqp
Timeline for d2pi2a_: