Lineage for d2pi2c_ (2pi2 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789413Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 2789414Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 2789417Domain d2pi2c_: 2pi2 C: [149495]
    Other proteins in same PDB: d2pi2e_, d2pi2f_, d2pi2g_, d2pi2h_
    automated match to d2pqaa_
    complexed with dio

Details for d2pi2c_

PDB Entry: 2pi2 (more details), 2 Å

PDB Description: Full-length Replication protein A subunits RPA14 and RPA32
PDB Compounds: (C:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d2pi2c_:

Sequence, based on SEQRES records: (download)

>d2pi2c_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
aqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapm
dvrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilev
inahmvlskan

Sequence, based on observed residues (ATOM records): (download)

>d2pi2c_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
aqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapm
dvrqwvsentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
lskan

SCOPe Domain Coordinates for d2pi2c_:

Click to download the PDB-style file with coordinates for d2pi2c_.
(The format of our PDB-style files is described here.)

Timeline for d2pi2c_: