Lineage for d2phda1 (2phd A:17-367)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070570Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer
  6. 2070571Protein Gentisate 1,2-dioxygenase [159300] (3 species)
    Salicylate 1,2-dioxygenase
  7. 2070577Species Pseudaminobacter salicylatoxidans [TaxId:93369] [159303] (1 PDB entry)
    Uniprot Q67FT0 17-367
  8. 2070578Domain d2phda1: 2phd A:17-367 [149468]
    Other proteins in same PDB: d2phdb_, d2phdc_, d2phdd_
    complexed with act, cl, fe

Details for d2phda1

PDB Entry: 2phd (more details), 2.9 Å

PDB Description: Crystal Structure Determination of a Salicylate 1,2-Dioxygenase from Pseudaminobacter salicylatoxidans
PDB Compounds: (A:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d2phda1:

Sequence, based on SEQRES records: (download)

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
pkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelvp
vgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegvw
tvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsdrv
tdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpat
vapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmng
ettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq

Sequence, based on observed residues (ATOM records): (download)

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
pkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelvp
vgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegvw
tvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsdtd
yatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatva
pghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmnget
tklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq

SCOPe Domain Coordinates for d2phda1:

Click to download the PDB-style file with coordinates for d2phda1.
(The format of our PDB-style files is described here.)

Timeline for d2phda1: