PDB entry 2phd

View 2phd on RCSB PDB site
Description: Crystal Structure Determination of a Salicylate 1,2-Dioxygenase from Pseudaminobacter salicylatoxidans
Class: oxidoreductase
Keywords: beta-sandwich, OXIDOREDUCTASE
Deposited on 2007-04-11, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gentisate 1,2-dioxygenase
    Species: Pseudaminobacter salicylatoxidans [TaxId:93369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67FT0
      • engineered (162)
    Domains in SCOPe 2.08: d2phda1
  • Chain 'B':
    Compound: Gentisate 1,2-dioxygenase
    Species: Pseudaminobacter salicylatoxidans [TaxId:93369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67FT0 (Start-367)
      • engineered (162)
    Domains in SCOPe 2.08: d2phdb_
  • Chain 'C':
    Compound: Gentisate 1,2-dioxygenase
    Species: Pseudaminobacter salicylatoxidans [TaxId:93369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67FT0
      • engineered (162)
    Domains in SCOPe 2.08: d2phdc_
  • Chain 'D':
    Compound: Gentisate 1,2-dioxygenase
    Species: Pseudaminobacter salicylatoxidans [TaxId:93369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67FT0
      • engineered (162)
    Domains in SCOPe 2.08: d2phdd_
  • Heterogens: FE, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2phdA (A:)
    mqnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwk
    wstllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehr
    hsqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipf
    sqqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdr
    alteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgs
    tvfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfm
    rtkiegqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phdA (A:)
    pkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelvp
    vgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegvw
    tvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsdtd
    yatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatva
    pghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmnget
    tklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2phdB (B:)
    mqnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwk
    wstllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehr
    hsqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipf
    sqqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdr
    alteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgs
    tvfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfm
    rtkiegqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phdB (B:)
    qpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelv
    pvgrerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegvwt
    vvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsddya
    tpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatvapg
    haairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmngettk
    lekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2phdC (C:)
    mqnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwk
    wstllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehr
    hsqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipf
    sqqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdr
    alteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgs
    tvfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfm
    rtkiegqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phdC (C:)
    qpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelv
    pvggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegvwt
    vvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsdrdy
    atpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatvap
    ghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmngett
    klekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2phdD (D:)
    mqnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwk
    wstllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehr
    hsqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipf
    sqqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdr
    alteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgs
    tvfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfm
    rtkiegqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phdD (D:)
    mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel
    vpvgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegeg
    vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd
    rvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqp
    atvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvm
    ngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkieg