Lineage for d2phdd_ (2phd D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404369Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer
  6. 2404381Protein automated matches [190924] (1 species)
    not a true protein
  7. 2404382Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries)
  8. 2404392Domain d2phdd_: 2phd D: [149471]
    Other proteins in same PDB: d2phda1
    automated match to d2phda1
    complexed with act, cl, fe

Details for d2phdd_

PDB Entry: 2phd (more details), 2.9 Å

PDB Description: Crystal Structure Determination of a Salicylate 1,2-Dioxygenase from Pseudaminobacter salicylatoxidans
PDB Compounds: (D:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d2phdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phdd_ b.82.1.23 (D:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel
vpvgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegeg
vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd
rvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqp
atvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvm
ngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkieg

SCOPe Domain Coordinates for d2phdd_:

Click to download the PDB-style file with coordinates for d2phdd_.
(The format of our PDB-style files is described here.)

Timeline for d2phdd_: