SCOPe 2.08: Domain d2phdd_: 2phd D:

Lineage for d2phdd_ (2phd D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer

6. Protein automated matches [190924] (1 species)
   not a true protein

7. Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries)

8. Domain d2phdd_: 2phd D: [149471]
   Other proteins in same PDB: d2phda1
   automated match to d2phda1
   complexed with act, cl, fe

Details for d2phdd_

PDB Entry: 2phd, 2.9 Å

PDB Description: crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans

PDB Compounds: (D:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d2phdd_:

Sequence; same for both SEQRES and ATOM records:

>d2phdd_ b.82.1.23 (D:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel
vpvgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegeg
vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd
rvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqp
atvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvm
ngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkieg

Timeline for d2phdd_:

• d2phdd_ first appeared in SCOP 1.75, called d2phdd1
  
• d2phdd_ appears in SCOPe 2.07