![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer |
![]() | Protein automated matches [190924] (1 species) not a true protein |
![]() | Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries) |
![]() | Domain d2phdb_: 2phd B: [149469] Other proteins in same PDB: d2phda1 automated match to d2phda1 complexed with act, cl, fe |
PDB Entry: 2phd (more details), 2.9 Å
SCOPe Domain Sequences for d2phdb_:
Sequence, based on SEQRES records: (download)
>d2phdb_ b.82.1.23 (B:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]} qpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelv pvgrggerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegv wtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsdr vtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpa tvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmn gettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegqk
>d2phdb_ b.82.1.23 (B:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]} qpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgelv pvgrerralglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegegvwt vvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsddya tpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatvapg haairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmngettk lekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegqk
Timeline for d2phdb_: