Lineage for d2pg4b_ (2pg4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694199Family a.4.5.48: F93-like [109674] (4 proteins)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 2694207Protein Uncharacterized protein APE0880.1 [158290] (1 species)
  7. 2694208Species Aeropyrum pernix [TaxId:56636] [158291] (1 PDB entry)
    Uniprot Q9YDN4 1-92
  8. 2694210Domain d2pg4b_: 2pg4 B: [149456]
    automated match to d2pg4a1
    complexed with cit, cl, edo, peg

Details for d2pg4b_

PDB Entry: 2pg4 (more details), 2.21 Å

PDB Description: crystal structure of a putative dna binding protein (ape_0880a) from aeropyrum pernix k1 at 2.21 a resolution
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2pg4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pg4b_ a.4.5.48 (B:) Uncharacterized protein APE0880.1 {Aeropyrum pernix [TaxId: 56636]}
detlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliraglvke
etlsyrvktlkltekgrrlaeclekcrdvlg

SCOPe Domain Coordinates for d2pg4b_:

Click to download the PDB-style file with coordinates for d2pg4b_.
(The format of our PDB-style files is described here.)

Timeline for d2pg4b_: