![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.48: F93-like [109674] (4 proteins) contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers |
![]() | Protein Uncharacterized protein APE0880.1 [158290] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [158291] (1 PDB entry) Uniprot Q9YDN4 1-92 |
![]() | Domain d2pg4b_: 2pg4 B: [149456] automated match to d2pg4a1 complexed with cit, cl, edo, peg |
PDB Entry: 2pg4 (more details), 2.21 Å
SCOPe Domain Sequences for d2pg4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pg4b_ a.4.5.48 (B:) Uncharacterized protein APE0880.1 {Aeropyrum pernix [TaxId: 56636]} detlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliraglvke etlsyrvktlkltekgrrlaeclekcrdvlg
Timeline for d2pg4b_: