![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
![]() | Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
![]() | Family b.12.1.0: automated matches [227174] (1 protein) not a true family |
![]() | Protein automated matches [226891] (5 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [255537] (1 PDB entry) |
![]() | Domain d2p0ma2: 2p0m A:2-112 [149137] Other proteins in same PDB: d2p0ma1, d2p0mb1 automated match to d2p0ma2 complexed with fe2, rs7 |
PDB Entry: 2p0m (more details), 2.4 Å
SCOPe Domain Sequences for d2p0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0ma2 b.12.1.0 (A:2-112) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg
Timeline for d2p0ma2: