Lineage for d2p0ma2 (2p0m A:2-112)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792566Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 792567Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 792568Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 792569Protein 15-Lipoxygenase [49728] (1 species)
  7. 792570Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49729] (2 PDB entries)
  8. 792571Domain d2p0ma2: 2p0m A:2-112 [149137]
    Other proteins in same PDB: d2p0ma1, d2p0mb1
    automatically matched to d1loxa2
    complexed with fe2, rs7

Details for d2p0ma2

PDB Entry: 2p0m (more details), 2.4 Å

PDB Description: Revised structure of rabbit reticulocyte 15S-lipoxygenase
PDB Compounds: (A:) Arachidonate 15-lipoxygenase

SCOP Domain Sequences for d2p0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0ma2 b.12.1.1 (A:2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg

SCOP Domain Coordinates for d2p0ma2:

Click to download the PDB-style file with coordinates for d2p0ma2.
(The format of our PDB-style files is described here.)

Timeline for d2p0ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p0ma1