Lineage for d2p0mb2 (2p0m B:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773710Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2773711Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2773794Family b.12.1.0: automated matches [227174] (1 protein)
    not a true family
  6. 2773795Protein automated matches [226891] (5 species)
    not a true protein
  7. 2773813Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [255537] (1 PDB entry)
  8. 2773815Domain d2p0mb2: 2p0m B:2-112 [149139]
    Other proteins in same PDB: d2p0ma1, d2p0mb1
    automated match to d2p0ma2
    complexed with fe2, rs7

Details for d2p0mb2

PDB Entry: 2p0m (more details), 2.4 Å

PDB Description: Revised structure of rabbit reticulocyte 15S-lipoxygenase
PDB Compounds: (B:) Arachidonate 15-lipoxygenase

SCOPe Domain Sequences for d2p0mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0mb2 b.12.1.0 (B:2-112) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg

SCOPe Domain Coordinates for d2p0mb2:

Click to download the PDB-style file with coordinates for d2p0mb2.
(The format of our PDB-style files is described here.)

Timeline for d2p0mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p0mb1