SCOPe 2.08: Domain d2p0mb2: 2p0m B:2-112

Lineage for d2p0mb2 (2p0m B:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [255537] (1 PDB entry)

8. Domain d2p0mb2: 2p0m B:2-112 [149139]
   Other proteins in same PDB: d2p0ma1, d2p0mb1
   automated match to d2p0ma2
   complexed with fe2, rs7

Details for d2p0mb2

PDB Entry: 2p0m, 2.4 Å

PDB Description: Revised structure of rabbit reticulocyte 15S-lipoxygenase

PDB Compounds: (B:) Arachidonate 15-lipoxygenase

SCOPe Domain Sequences for d2p0mb2:

Sequence; same for both SEQRES and ATOM records:

>d2p0mb2 b.12.1.0 (B:2-112) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg

Timeline for d2p0mb2:

• d2p0mb2 first appeared in SCOP 1.75
  
• d2p0mb2 appears in SCOPe 2.07