Class a: All alpha proteins [46456] (290 folds) |
Fold a.119: Lipoxigenase [48483] (1 superfamily) multihelical large nearly all-alpha domain |
Superfamily a.119.1: Lipoxigenase [48484] (3 families) |
Family a.119.1.2: Animal lipoxigenases [48489] (2 proteins) automatically mapped to Pfam PF00305 |
Protein automated matches [254620] (1 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [255538] (1 PDB entry) |
Domain d2p0ma1: 2p0m A:113-663 [149136] Other proteins in same PDB: d2p0ma2, d2p0mb2 automated match to d1loxa1 complexed with fe2, rs7 |
PDB Entry: 2p0m (more details), 2.4 Å
SCOPe Domain Sequences for d2p0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0ma1 a.119.1.2 (A:113-663) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tgcttvgdpqglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkk idfeaslawglaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyq flnganpmllrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvily cqqylaaplvmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssd fqvhelnshllrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdf gifdqimstgggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweii sryvqgimglyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtm ciftctgqhssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlhqsslqms ivwqlgrdqpimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeyl rpsivensvai
Timeline for d2p0ma1: