Lineage for d2p0ma1 (2p0m A:113-663)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008120Family a.119.1.2: Animal lipoxigenases [48489] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008124Protein automated matches [254620] (1 species)
    not a true protein
  7. 2008125Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [255538] (1 PDB entry)
  8. 2008126Domain d2p0ma1: 2p0m A:113-663 [149136]
    Other proteins in same PDB: d2p0ma2, d2p0mb2
    automated match to d1loxa1
    complexed with fe2, rs7

Details for d2p0ma1

PDB Entry: 2p0m (more details), 2.4 Å

PDB Description: Revised structure of rabbit reticulocyte 15S-lipoxygenase
PDB Compounds: (A:) Arachidonate 15-lipoxygenase

SCOPe Domain Sequences for d2p0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0ma1 a.119.1.2 (A:113-663) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgcttvgdpqglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkk
idfeaslawglaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyq
flnganpmllrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvily
cqqylaaplvmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssd
fqvhelnshllrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdf
gifdqimstgggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweii
sryvqgimglyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtm
ciftctgqhssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlhqsslqms
ivwqlgrdqpimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeyl
rpsivensvai

SCOPe Domain Coordinates for d2p0ma1:

Click to download the PDB-style file with coordinates for d2p0ma1.
(The format of our PDB-style files is described here.)

Timeline for d2p0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p0ma2