![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (10 species) not a true protein |
![]() | Domain d2oanc2: 2oan C:147-371 [148711] Other proteins in same PDB: d2oana1, d2oanb1, d2oanc1, d2oand1 automated match to d1d4xa2 complexed with atp, ca, so4 |
PDB Entry: 2oan (more details), 2.61 Å
SCOPe Domain Sequences for d2oanc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oanc2 c.55.1.1 (C:147-371) automated matches {Cow (Bos taurus) [TaxId: 9913]} rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh
Timeline for d2oanc2: