Lineage for d2oanc2 (2oan C:147-371)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372729Protein automated matches [226905] (10 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [225259] (2 PDB entries)
  8. 1372737Domain d2oanc2: 2oan C:147-371 [148711]
    Other proteins in same PDB: d2oana1, d2oanb1, d2oanc1, d2oand1
    automated match to d1d4xa2
    complexed with atp, ca, so4

Details for d2oanc2

PDB Entry: 2oan (more details), 2.61 Å

PDB Description: structure of oxidized beta-actin
PDB Compounds: (C:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oanc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oanc2 c.55.1.1 (C:147-371) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh

SCOPe Domain Coordinates for d2oanc2:

Click to download the PDB-style file with coordinates for d2oanc2.
(The format of our PDB-style files is described here.)

Timeline for d2oanc2: