SCOPe 2.03: Domain d2oana1: 2oan A:6-146

Lineage for d2oana1 (2oan A:6-146)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226802] (2 PDB entries)

8. Domain d2oana1: 2oan A:6-146 [148706]
   Other proteins in same PDB: d2oana2, d2oanb2, d2oanc2, d2oand2
   automated match to d1d4xa1
   complexed with atp, ca, so4

Details for d2oana1

PDB Entry: 2oan, 2.61 Å

PDB Description: structure of oxidized beta-actin

PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oana1:

Sequence, based on SEQRES records:

>d2oana1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d2oana1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehgi
vtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyva
iqavlslyasg

Timeline for d2oana1:

• d2oana1 first appeared in SCOP 1.75
  
• d2oana1 appears in SCOPe 2.02
  
• d2oana1 appears in SCOPe 2.04
  
• d2oana1 appears in the current release, SCOPe 2.08