Lineage for d2oanb1 (2oan B:4-146)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [226802] (2 PDB entries)
  8. 1373394Domain d2oanb1: 2oan B:4-146 [148708]
    Other proteins in same PDB: d2oana2, d2oanb2, d2oanc2, d2oand2
    automated match to d1d4xa1
    complexed with atp, ca, so4

Details for d2oanb1

PDB Entry: 2oan (more details), 2.61 Å

PDB Description: structure of oxidized beta-actin
PDB Compounds: (B:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oanb1:

Sequence, based on SEQRES records: (download)

>d2oanb1 c.55.1.0 (B:4-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
diaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d2oanb1 c.55.1.0 (B:4-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
diaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypieh
givtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamy
vaiqavlslyasg

SCOPe Domain Coordinates for d2oanb1:

Click to download the PDB-style file with coordinates for d2oanb1.
(The format of our PDB-style files is described here.)

Timeline for d2oanb1: