SCOPe 2.02: Domain d2oanc2: 2oan C:147-371

Lineage for d2oanc2 (2oan C:147-371)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (5 PDB entries)

8. Domain d2oanc2: 2oan C:147-371 [148711]
   automatically matched to d1hlua2
   complexed with atp, ca, so4

Details for d2oanc2

PDB Entry: 2oan, 2.61 Å

PDB Description: structure of oxidized beta-actin

PDB Compounds: (C:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oanc2:

Sequence; same for both SEQRES and ATOM records:

>d2oanc2 c.55.1.1 (C:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh

Timeline for d2oanc2:

• d2oanc2 first appeared in SCOP 1.75
  
• d2oanc2 appears in SCOPe 2.01
  
• d2oanc2 appears in SCOPe 2.03
  
• d2oanc2 appears in the current release, SCOPe 2.08