![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order |
![]() | Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) ![]() contains metal-binding site on the bundle surface surrounded by loops |
![]() | Family a.213.1.4: Maleylpyruvate isomerase-like [158522] (1 protein) automatically mapped to Pfam PF11716 |
![]() | Protein Micothiol-dependent maleylpyruvate isomerase [158523] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [158524] (2 PDB entries) Uniprot Q8NLC1 1-160 Cgl3021 |
![]() | Domain d2nsga1: 2nsg A:1-160 [148388] Other proteins in same PDB: d2nsga2 complexed with gol, so4; mutant |
PDB Entry: 2nsg (more details), 2.05 Å
SCOPe Domain Sequences for d2nsga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsga1 a.213.1.4 (A:1-160) Micothiol-dependent maleylpyruvate isomerase {Corynebacterium glutamicum [TaxId: 1718]} mttfhdlpleerltlarlgtshysrqlslvdnaefgehsllegwtrshliaavaynaial cnlmhwantgeetpmyvspearneeiaygstlnpdalrnlhehsvarldvawretsedaw shevltaqgrtvpasetlwmrsrevwihavdlgavatfgd
Timeline for d2nsga1: