PDB entry 2nsg

View 2nsg on RCSB PDB site
Description: Crystal structure of the mycothiol-dependent maleylpyruvate isomerase H52A mutant
Class: isomerase
Keywords: H52A mutant, ISOMERASE
Deposited on 2006-11-04, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Cgl3021
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NLC1 (20-End)
      • engineered (71)
    Domains in SCOPe 2.08: d2nsga1, d2nsga2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nsgA (A:)
    mgsshhhhhhssglvprgshmttfhdlpleerltlarlgtshysrqlslvdnaefgehsl
    legwtrshliaavaynaialcnlmhwantgeetpmyvspearneeiaygstlnpdalrnl
    hehsvarldvawretsedawshevltaqgrtvpasetlwmrsrevwihavdlgavatfgd
    ipevilrtlaaeitqkwtsqgageglvlldepsstrypaapgqdevvvsgslagivryaa
    grgsdgvtsstgevpepprwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nsgA (A:)
    mttfhdlpleerltlarlgtshysrqlslvdnaefgehsllegwtrshliaavaynaial
    cnlmhwantgeetpmyvspearneeiaygstlnpdalrnlhehsvarldvawretsedaw
    shevltaqgrtvpasetlwmrsrevwihavdlgavatfgdipevilrtlaaeitqkwtsq
    gageglvlldepsstrypaapgqdevvvsgslagivryaagrgsdgvtsstgevpepprw