SCOP 1.75: Domain d2nsga1: 2nsg A:1-160

Lineage for d2nsga1 (2nsg A:1-160)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.4: Maleylpyruvate isomerase-like [158522] (1 protein)

6. Protein Micothiol-dependent maleylpyruvate isomerase [158523] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [158524] (2 PDB entries)
   Uniprot Q8NLC1 1-160
   Cgl3021

8. Domain d2nsga1: 2nsg A:1-160 [148388]
   Other proteins in same PDB: d2nsga2
   complexed with gol, so4; mutant

Details for d2nsga1

PDB Entry: 2nsg, 2.05 Å

PDB Description: crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant

PDB Compounds: (A:) Hypothetical protein Cgl3021

SCOP Domain Sequences for d2nsga1:

Sequence; same for both SEQRES and ATOM records:

>d2nsga1 a.213.1.4 (A:1-160) Micothiol-dependent maleylpyruvate isomerase {Corynebacterium glutamicum [TaxId: 1718]}
mttfhdlpleerltlarlgtshysrqlslvdnaefgehsllegwtrshliaavaynaial
cnlmhwantgeetpmyvspearneeiaygstlnpdalrnlhehsvarldvawretsedaw
shevltaqgrtvpasetlwmrsrevwihavdlgavatfgd

Timeline for d2nsga1:

• d2nsga1 is new in SCOP 1.75
  
• d2nsga1 appears in SCOPe 2.01
  
• d2nsga1 appears in the current release, SCOPe 2.08