SCOPe 2.08: Domain d2nsga2: 2nsg A:161-240

Lineage for d2nsga2 (2nsg A:161-240)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.2: Micothiol-dependent maleylpyruvate isomerase C-terminal domain-like [160614] (1 protein)
   lacking the short edge strand 3

6. Protein Micothiol-dependent maleylpyruvate isomerase [160615] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [160616] (2 PDB entries)
   Uniprot Q8NLC1 161-240
   Cgl3021

8. Domain d2nsga2: 2nsg A:161-240 [148389]
   Other proteins in same PDB: d2nsga1
   complexed with gol, so4; mutant

Details for d2nsga2

PDB Entry: 2nsg, 2.05 Å

PDB Description: crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant

PDB Compounds: (A:) Hypothetical protein Cgl3021

SCOPe Domain Sequences for d2nsga2:

Sequence; same for both SEQRES and ATOM records:

>d2nsga2 d.106.1.2 (A:161-240) Micothiol-dependent maleylpyruvate isomerase {Corynebacterium glutamicum [TaxId: 1718]}
ipevilrtlaaeitqkwtsqgageglvlldepsstrypaapgqdevvvsgslagivryaa
grgsdgvtsstgevpepprw

Timeline for d2nsga2:

• d2nsga2 first appeared in SCOP 1.75
  
• d2nsga2 appears in SCOPe 2.07