![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
![]() | Superfamily d.106.1: SCP-like [55718] (5 families) ![]() |
![]() | Family d.106.1.2: Micothiol-dependent maleylpyruvate isomerase C-terminal domain-like [160614] (1 protein) lacking the short edge strand 3 |
![]() | Protein Micothiol-dependent maleylpyruvate isomerase [160615] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [160616] (2 PDB entries) Uniprot Q8NLC1 161-240 Cgl3021 |
![]() | Domain d2nsga2: 2nsg A:161-240 [148389] Other proteins in same PDB: d2nsga1 complexed with gol, so4; mutant |
PDB Entry: 2nsg (more details), 2.05 Å
SCOPe Domain Sequences for d2nsga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsga2 d.106.1.2 (A:161-240) Micothiol-dependent maleylpyruvate isomerase {Corynebacterium glutamicum [TaxId: 1718]} ipevilrtlaaeitqkwtsqgageglvlldepsstrypaapgqdevvvsgslagivryaa grgsdgvtsstgevpepprw
Timeline for d2nsga2: