SCOPe 2.08: Domain d2ivya_: 2ivy A:

Lineage for d2ivya_ (2ivy A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins)
   Pfam PF09827

6. Protein automated matches [190721] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [187879] (1 PDB entry)

8. Domain d2ivya_: 2ivy A: [147817]
   automated match to d2i8ea1

Details for d2ivya_

PDB Entry: 2ivy, 1.4 Å

PDB Description: crystal structure of hypothetical protein sso1404 from sulfolobus solfataricus p2

PDB Compounds: (A:) hypothetical protein sso1404

SCOPe Domain Sequences for d2ivya_:

Sequence; same for both SEQRES and ATOM records:

>d2ivya_ d.58.58.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
amlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkk
lqederffilivpitenqfrerivigys

Timeline for d2ivya_:

• d2ivya_ first appeared in SCOP 1.75, called d2ivya1
  
• d2ivya_ appears in SCOPe 2.07