Lineage for d2ivya_ (2ivy A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562976Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2562977Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins)
    Pfam PF09827
  6. 2562997Protein automated matches [190721] (2 species)
    not a true protein
  7. 2562998Species Sulfolobus solfataricus [TaxId:273057] [187879] (1 PDB entry)
  8. 2562999Domain d2ivya_: 2ivy A: [147817]
    automated match to d2i8ea1

Details for d2ivya_

PDB Entry: 2ivy (more details), 1.4 Å

PDB Description: crystal structure of hypothetical protein sso1404 from sulfolobus solfataricus p2
PDB Compounds: (A:) hypothetical protein sso1404

SCOPe Domain Sequences for d2ivya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivya_ d.58.58.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
amlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkk
lqederffilivpitenqfrerivigys

SCOPe Domain Coordinates for d2ivya_:

Click to download the PDB-style file with coordinates for d2ivya_.
(The format of our PDB-style files is described here.)

Timeline for d2ivya_: