SCOP 1.75: Domain d2ivya1: 2ivy A:2-89

Lineage for d2ivya1 (2ivy A:2-89)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: TTP0101/SSO1404-like [143430] (1 family)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.1: TTP0101/SSO1404-like [143431] (3 proteins)
   Pfam PF02647; DUF196; this family includes recent structure of SSO1404 (PDB entry 2IVY)

6. Protein Hypothetical protein SSO1404 [160348] (1 species)
   predicted DNA repair associated protein

7. Species Sulfolobus solfataricus [TaxId:2287] [160349] (2 PDB entries)
   Uniprot Q97YC2 2-89

8. Domain d2ivya1: 2ivy A:2-89 [147817]
   automatically matched to 2I8E A:2-89

Details for d2ivya1

PDB Entry: 2ivy, 1.4 Å

PDB Description: crystal structure of hypothetical protein sso1404 from sulfolobus solfataricus p2

PDB Compounds: (A:) hypothetical protein sso1404

SCOP Domain Sequences for d2ivya1:

Sequence; same for both SEQRES and ATOM records:

>d2ivya1 d.58.58.1 (A:2-89) Hypothetical protein SSO1404 {Sulfolobus solfataricus [TaxId: 2287]}
amlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkk
lqederffilivpitenqfrerivigys

Timeline for d2ivya1:

• d2ivya1 is new in SCOP 1.75
  
• d2ivya1 is called d2ivya_ in SCOPe 2.01
  
• d2ivya1 appears in the current release, SCOPe 2.08, called d2ivya_